FANDOM


==  Interesting Images from Pymol==


Homework-1

The full structure of MDR1. It is made up of 12 transmembrane helixes and 2 ATP binding subunits.








Homework -2

A surface map of MDR1 in Pymol.

Homework-3

A depiction of the flexible linker region of MDR1. The linker region is missing in the structure but is present between the blue and red colored amino acids.















Homologous ProteinsEdit

Human MDR 1 compared to Macaca mulatta MDR

multidrug resistance protein [Macaca mulatta] Sequence ID: gb|AAS91648.1|Length: 1283Number of Matches: 1Related Information[PUID&RID=PMSF47G301R&log$=genealign&blast_rank=17 Gene]-associated gene detailsRange 1: 1 to 1283GenPept[46394984&tracks=[key:sequence_track,name:Sequence,display_name:Sequence,id:STD1,category:Sequence,annots:Sequence,ShowLabel:true][key:gene_model_track,CDSProductFeats:false][key:alignment_track,name:other%20alignments,annots:NG%20Alignments%7CRefseq%20Alignments%7CGnomon%20Alignments%7CUnnamed,shown:false]&v=0:1347&appname=ncbiblast&link_loc=fromHSP Graphics] Next Match Previous Match

Alignment statistics for match #1
Score Expect Method Identities Positives Gaps
2526 bits(6547) 0.0 Compositional matrix adjust. 1232/1283(96%) 1254/1283(97%) 3/1283(0%)
Query  1     MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII  60
             MDLEGDRNGGA+KKNFFKLNNKS+KDKKE+KPTVSVFSMFRYSNWLDKLYMVVGTLAAII
Sbjct  1     MDLEGDRNGGAEKKNFFKLNNKSKKDKKERKPTVSVFSMFRYSNWLDKLYMVVGTLAAII  60

Query  61    HGAGLPLMMLVFGEMTDIFANAGNLEDL---MSNITNRSDINDTGFFMNLEEDMTRYAYY  117
             HGAGLPLMMLVFG+MTD FANAGNL DL   + N TN S+I DT   MNLEEDMTRYAYY
Sbjct  61    HGAGLPLMMLVFGDMTDTFANAGNLGDLGALLFNNTNSSNITDTVPVMNLEEDMTRYAYY  120

Query  118   YSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD  177
             YSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD
Sbjct  121   YSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD  180

Query  178   DVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILS  237
             +VSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISP+LGLSAA WAKILS
Sbjct  181   EVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPILGLSAAAWAKILS  240

Query  238   SFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI  297
             SFTDKELLAYAKAG VAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI
Sbjct  241   SFTDKELLAYAKAGVVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI  300

Query  298   SIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFAN  357
             SIGAAFLLIYASYALAFWYGTTLVLS EYSIGQVLTVFFSVLIGAFSVGQASPSIEAFAN
Sbjct  301   SIGAAFLLIYASYALAFWYGTTLVLSKEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFAN  360

Query  358   ARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKV  417
             ARGAA+EIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKV
Sbjct  361   ARGAAFEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKV  420

Query  418   QSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEP  477
             QSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEP
Sbjct  421   QSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEP  480

Query  478   VLFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQ  537
             VLFATTIAENIRYGRE+VTMDEIEKAVKEANAYDFIMKLP KFDTLVGERGAQLSGGQKQ
Sbjct  481   VLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPQKFDTLVGERGAQLSGGQKQ  540

Query  538   RIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADV  597
             RIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADV
Sbjct  541   RIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADV  600

Query  598   IAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSND  657
             IAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNE+ELENAADESKSEID LEMSS+D
Sbjct  601   IAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEIELENAADESKSEIDTLEMSSHD  660

Query  658   SRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFC  717
             S SSLIRKRSTRRSVRGSQ QDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFC
Sbjct  661   SGSSLIRKRSTRRSVRGSQGQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFC  720

Query  718   AIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTF  777
             AIINGGLQPAFA+IFSKIIG+FTR DD ETK+QNSNLFSLLFL LGI+SFITFFLQGFTF
Sbjct  721   AIINGGLQPAFAVIFSKIIGIFTRNDDAETKQQNSNLFSLLFLVLGIVSFITFFLQGFTF  780

Query  778   GKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVIT  837
             GKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLA+IT
Sbjct  781   GKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAIIT  840

Query  838   QNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIA  897
             QNIANLGTGIIIS IYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEG+GKIA
Sbjct  841   QNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGAGKIA  900

Query  898   TEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCF  957
             TEAIENFRTVVSLTQEQKFEHMY QSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCF
Sbjct  901   TEAIENFRTVVSLTQEQKFEHMYDQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCF  960

Query  958   RFGAYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPL  1017
             RFGAYLVAH LMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAK+SAAHIIMIIEKTPL
Sbjct  961   RFGAYLVAHSLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKVSAAHIIMIIEKTPL  1020

Query  1018  IDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKS  1077
             IDSYSTEGL PNTLEGNVTF EVVFNYPTR DIPVLQGLSLEVKKGQTLALVGSSGCGKS
Sbjct  1021  IDSYSTEGLKPNTLEGNVTFNEVVFNYPTRLDIPVLQGLSLEVKKGQTLALVGSSGCGKS  1080

Query  1078  TVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNS  1137
             TVVQLLERFYDPLAGKVLLDGKEIK+LNVQWLRAHLGIVSQEPILFDCSI+ENIAYGDNS
Sbjct  1081  TVVQLLERFYDPLAGKVLLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSISENIAYGDNS  1140

Query  1138  RVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHIL  1197
             RVVSQEEIVRAAKEANIHAFIESLPNKYST+VGDKGTQLSGGQKQRIAIARALVRQPHIL
Sbjct  1141  RVVSQEEIVRAAKEANIHAFIESLPNKYSTRVGDKGTQLSGGQKQRIAIARALVRQPHIL  1200

Query  1198  LLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTH  1257
             LLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTH
Sbjct  1201  LLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTH  1260

Query  1258  QQLLAQKGIYFSMVSVQAGTKRQ  1280
             QQLLAQKGIYFSMVSVQAG KRQ
Sbjct  1261  QQLLAQKGIYFSMVSVQAGAKRQ  1283

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.