FANDOM


P-Glycoprotein CompositionEdit

The human p-glycoprotein is 1280 Amino Acids long and is 170kD.

The NCBI reference page can be found HERE

Reference Amino Acid SequenceEdit

>gi|42741659|ref|NP_000918.2| multidrug resistance protein 1 [Homo sapiens]
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAIIHGAGLPLMML
VFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSGIGAGVLVAAYIQVSFWCLAA
GRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTR
GWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKN
LEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASP
SIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRY
GRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSA
LDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQT
AGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRI
MKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITF
FLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSL
TQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAHKLMSFEDVLLVFSA
VVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDI
PVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEP
ILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARAL
VRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ


Amino Acid CompositonEdit

Amino acid composition: 
Ala (A) 117	  9.1%
Arg (R)  63	  4.9%
Asn (N)  53	  4.1%
Asp (D)  56	  4.4%
Cys (C)   7	  0.5%
Gln (Q)  53	  4.1%
Glu (E)  75	  5.9%
Gly (G)  99	  7.7%
His (H)  19	  1.5%
Ile (I) 104	  8.1%
Leu (L) 119	  9.3%
Lys (K)  85	  6.6%
Met (M)  32	  2.5%
Phe (F)  70	  5.5%
Pro (P)  29	  2.3%
Ser (S)  88	  6.9%
Thr (T)  69	  5.4%
Trp (W)  11	  0.9%
Tyr (Y)  35	  2.7%
Val (V)  96	  7.5%
Pyl (O)   0	  0.0%
Sec (U)   0	  0.0%

 (B)   0	  0.0%
 (Z)   0	  0.0%
 (X)   0	  0.0%

More InformationEdit

  1. Yuzo: P-Glycoprotein: Introduction
  2. Yuzo: P-Glycoprotein: Biological function
  3. Yuzo: P-Glycoprotein: Biosynthesis
  4. Yuzo: P-Glycoprotein: Gene sequence
  5. Yuzo: P-Glycoprotein: Amino acid sequence and composition
  6. Yuzo: P-Glycoprotein: Domains and structural motifs
  7. Yuzo: P-Glycoprotein: Interactions with macromolecules and small molecules
  8. Yuzo: P-Glycoprotein: Molecular biodiversity and evolution
  9. Yuzo: P-Glycoprotein: Literature overview
  10. Yuzo: P-Glycoprotein: Online resources

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.