FANDOM


Of the 3291bp lethal factor sequence, bp 481-579 denote the signal peptide and bp 481-2910 denote the lethal factor protein. The amino acid sequence was found at NCBI. Anthrax lethal factor has a molecular weight of 93728.3. 
Lethal Factor Sequence

"The N-terminal 26 residues are invisible in our electron density maps, and we presume that they are disordered. All other residues are ordered in at least one crystal form. The five sequence repeats are indicated R1–R5. The zinc-coordinating residues are highlighted in red. The sequence of domain I is homologous to the PA-binding domain of oedema factor, and its three-dimensional structure will be similar. For domain II, secondary structure nomenclature matches that of the N-terminal domain of VIP2." Andrew D. Pannifer et al. Nature. 2001. http://www.nature.com/nature/journal/v414/n6860/fig_tab/414229a0_F2.html

Amino Acid SequenceEdit

>gi|446944843|ref|WP_001022099.1| Lethal factor [Bacillus anthracis]
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLK
EIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDI
YGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTI
KNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKF
NEQEINLSLEELKDQRMLTRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKE
LLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDS
TDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGL
EIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVE
SAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSIL
LHGPSKGVGLRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFF
AEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS

Amino Acid CompositionEdit

 

Ala (A)  34        4.2%

Arg (R)  27        3.3%

Asn (N)  54       6.7%

Asp (D)  55      6.8%

Cys (C)   1        0.1%

Gln (Q)  41       5.1%

Glu (E)  78        9.6%

Gly (G)  36       4.4%

His (H)  21        2.6%

Ile (I)  74           9.1%

Leu (L)  80        9.9%

Lys (K)  86      10.6%

Met (M)  10      1.2%

Phe (F)  29       3.6%

Pro (P)  21       2.6%

Ser (S)  53       6.6%

Thr (T)  29       3.6%

Trp (W)   5       0.6%

Tyr (Y)  35       4.3%

Val (V)  40       4.9%

The protein is rich in glutamic acid, isoleucine, leucine, and lysine. 

Project PagesEdit

  1. Patrick: Anthrax Toxin: Introduction 
  2. Patrick: Anthrax Toxin: Biological Function
  3. Patrick: Anthrax Toxin: Biosynthesis
  4. Patrick: Anthrax Toxin: Gene Sequence
  5. Patrick: Anthrax Toxin: Amino Acid Sequence and Composition
  6. Patrick: Anthrax Toxin: Secondary and Tertiary Structure
  7. Patrick: Anthrax Toxin: Domains and Structural Motifs
  8. Patrick: Anthrax Toxin: Interactions with macromolecules and small molecules
  9. Patrick: Anthrax Toxin: Molecular biodiversity and evolution
  10. Patrick: Anthrax Toxin: PyMOL Images
  11. Patrick: Anthrax Toxin: Literature Review
  12. Patrick: Anthrax Toxin: Useful online resources

ReferencesEdit

Amino Acid Composition Calculator 

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.