FANDOM


HIV-1 protease is comprised of 99 amino acids and has a molecular weight of 10,799 daltons.Edit

The NCBI reference sequence for this protein is NP_705926.1

Amino acid sequence of HIV-1 protease reference sequence (FASTA format)Edit

>gi|25121906|ref|NP_705926.1| retropepsin [Human immunodeficiency virus 1]
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHK
AIGTVLVGPTPVNIIGRNLLTQIGCTLNF

Amino acid composition of HIV-1 proteaseEdit

Freq
A: 3      3.0%
C: 2      2.0%
D: 4      4.0%
E: 4      4.0%
F: 2      2.0%
G: 13    13.1%
H: 1      1.0%
I: 12    12.1%
K: 6      6.1%
L: 12    12.1%
M: 2      2.0%
N: 3      3.0%
P: 6      6.1%
Q: 6      6.1%
R: 4      4.0%
S: 1      1.0%
T: 8      8.1%
V: 7      7.1%
W: 2      2.0%
Y: 1      1.0%

The protein is rich in glycine, isoleucine and leucine, and has relatively small quantities of cysteine, histidine, serine and tyrosine.

Hydrophobicity, charge distribution and predicted secondary structure


Protease preducted structure