FANDOM


HIV-1 protease is comprised of 99 amino acids and has a molecular weight of 10,799 daltons.Edit

The NCBI reference sequence for this protein is NP_705926.1

Amino acid sequence of HIV-1 protease reference sequence (FASTA format)Edit

>gi|25121906|ref|NP_705926.1| retropepsin [Human immunodeficiency virus 1]
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHK
AIGTVLVGPTPVNIIGRNLLTQIGCTLNF

Amino acid composition of HIV-1 proteaseEdit

Freq
A: 3      3.0%
C: 2      2.0%
D: 4      4.0%
E: 4      4.0%
F: 2      2.0%
G: 13    13.1%
H: 1      1.0%
I: 12    12.1%
K: 6      6.1%
L: 12    12.1%
M: 2      2.0%
N: 3      3.0%
P: 6      6.1%
Q: 6      6.1%
R: 4      4.0%
S: 1      1.0%
T: 8      8.1%
V: 7      7.1%
W: 2      2.0%
Y: 1      1.0%

The protein is rich in glycine, isoleucine and leucine, and has relatively small quantities of cysteine, histidine, serine and tyrosine.

Hydrophobicity, charge distribution and predicted secondary structure


Protease preducted structure

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.