FANDOM


Cytochrome p450 is a protein made up of roughly 502 amino acids based on the specific enzyme. The specific version of cytochrome p450 that we are looking at is cytochrome p450 3A4 .  Cytochrome p450 has a molecular weight of 55,778 Daltons. 

FASTA SequenceEdit

>gi|322302351|ref|NP_001189784.1| cytochrome P450 3A4 isoform 2 [Homo sapiens]
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGK
VWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSG
KLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKL
LRFDFLDPFFLSIIFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNS
KETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVL
QMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSK
KNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVL
KVESRDGTVSGA


Amino Acid CompostionEdit

Ala (A): 4.0%

Arg (R): 4.4%

Asn (N): 3.6%

Asp (D): 5.2%

Cys (C): 1.4%

Gln (Q): 3.0%

Glu (E): 6.2%

Gly (G): 5.2%

His (H): 1.6%

Ile (I): 6.2%

Leu (L): 11.8%

Lys (K): 7.6%

Met (M): 3.8%

Phe (F): 6.4%

Pro (P): 7.0%

Ser (S): 6.2%

Thr (T): 5.2%

Trp (W): 0.8%

Tyr (Y): 3.2%

Val (V): 7.6%

This protein is rich in Leucine, Lysine, Proline, and Valine. It also had a similar number of positively and negatively charged residues. 

57 negatively charged residues (Asp and Glu) & 60 positively charged residues (Arg and Lys)


PagesEdit

  1. Alessandra: Cytochrome p450: Introduction
  2. Alessandra: Cytochrome p450: Biological function
  3. Alessandra: Cytochrome p450: Biosynthesis
  4. Alessandra: Cytochrome p450: Gene sequence
  5. Alessandra: Cytochrome p450: Amino acid sequence and composition
  6. Alessandra: Cytochrome p450: Secondary and tertiary structure
  7. Alessandra: Cytochrome p450: Domains and structural motifs
  8. Alessandra: Cytochrome p450: Interactions with macromolecules and small molecules
  9. Alessandra: Cytochrome p450: Molecular biodiversity and evolution
  10. Alessandra: Cytochrome p450: Literature overview
  11. Alessandra: Cytochrome p450: Useful online resources

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.